IGFBP3 antibody orb316573 from Biorbyt

Product Specs
ItemIGFBP3 antibody
CompanyBiorbyt
Price Pricing Info Supplier Page
Catalog Numberorb316573
Quantity10 µg, 100 µg
ApplicationsELISA, IHC, WB
Conjugate/TagUnconjugated
FormatLyophilized
ReactivityHuman, Mouse, Rat
TargetIGFBP3
IsotypeRabbit IgG
HostRabbit
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP-3 (214-252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR), identical to the related mouse and rat sequences
NCBI Full Gene Nameinsulin like growth factor binding protein 3
NCBI Gene AliasesBP-53, IBP3
ClonalityPolyclonal
Molecular Weight31674 MW
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 µg/ml
StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles

Specifications/Features

Application Notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Application Dilutions: Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, By Heat ELISA, 0.1-0.5µg/ml, Human, -Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat

Add to Compare List